Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C17orf78 (C17orf78)

This Recombinant Human Uncharacterized protein C17orf78 (C17orf78) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf78

UniProt

Q8N4C9

Expression Region

1-275

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTILVFSLIIASYDANKKDLRDSSCRLEQLPGIFPKDVRSIRELQMQETHTETKRTTFI QNRTIATLQCLGSDSKVKVNLVYLERRPKVKHILKNLRIIAAPRRNSSASSSCHLIPTSK FQTGSLLKGKAFLPGISQCKVLGASSETFPTTAPSITPGNKEGEKTTSTDTDENLEKRQK WSIVVKILIAVTLLLSGVAIIVFVIFEVPCPYQCLGARKLCQCQWLWRWQKKGGQPPGTA ESKPDSQPQKVGQDAANSSNPKKAAEITVIHQTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caveolin 3 (CAV3) (NM_001234) Human Over-expression Lysate
LC420058 20 µg

Caveolin 3 (CAV3) (NM_001234) Human Over-expression Lysate

Sign In for Pricing
View Details
VGLUT2 Recombinant Chimeric Antibody Antibody
HA610235 100 µg

VGLUT2 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
KMT5A Mouse Monoclonal Antibody [Clone ID: OTI5E5]
CF808217 100 µg

KMT5A Mouse Monoclonal Antibody [Clone ID: OTI5E5]

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Guinea Pig IgG,
AA-2303-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Guinea Pig IgG,

Sign In for Pricing
View Details
MORN1 Human Gene Knockout Kit (CRISPR)
KN415575 1 Kit

MORN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LHX9 Antibody
KC-2761-01 50 μL

LHX9 Antibody

Sign In for Pricing
View Details