Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Virion egress protein UL34 (UL34)

This Recombinant Human herpesvirus 1 Virion egress protein UL34 (UL34) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Virion egress protein UL34, Primary envelopment factor UL34

UniProt

P10218

Expression Region

1-275

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGLGKPYTGHPGDAFEGLVQRIRLIVPSTLRGGDGEAGPYSPSSLPSRCAFQFHGHDGS DESFPIEYVLRLMNDWAEVPCNPYLRIQNTGVSVLFQGFFHRPHNAPGGAITPERTNVIL GSTETTGLSLGDLDTIKGRLGLDARPMMASMWISCFVRMPRVQLAFRFMGPEDAGRTRRI LCRAAEQAITRRRRTRRSREAYGAEAGLGVAGTGFRARGDGFGPLPLLTQGPSRPWHQAL RGLKHLRIGPPALVLAAGLVLGAAIWWVVGAGARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-100 1x 100 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-100 1x 100 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P57 / KIP2 (KP10 + KIP2/880), CF640R conjugate, 0.1mg/mL
BNC401015-100 1x 100 µL

P57 / KIP2 (KP10 + KIP2/880), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P57 / KIP2 (KP10), CF740 conjugate, 0.1mg/mL
BNC740879-500 1x 500 µL

P57 / KIP2 (KP10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (13C4), CF555 conjugate, 0.1mg/mL
BNC550147-500 1x 500 µL

Pgp9.5 (UCHL-1) (13C4), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-100 1x 100 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details