Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 53 (Tmem53)

This Recombinant Mouse Transmembrane protein 53 (Tmem53) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Transmembrane protein 53

UniProt

Q9D0Z3

Expression Region

1-276

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAELDYSIEIPDQPCWSQKNRQGGKEAGKQQPVVILLGWGGCRDKNLAKYSAIYHKRG CIVIRYTAPWHMVFFSESLGIPSLRVIAQKLLELLFDYEIEREPLLFHVFSNAGVMLYRY VLELLQTHQRFRHLHVVGTIFDSGPGDSNLIGALRALATILERRPAVLRLLLLAAFALVV ILFHFLLAPFTALFHTHFYDRLQDSGSCWPELYLYSRADKVVSARDVERMVEARLAHQVM VRGVDFVSSAHVSHLRDYPTYYTSLCVDFMHNCVQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tarsl2 3'UTR GFP Stable Cell Line
TU271580 1.0 mL

Tarsl2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Galnt3 (NM_015736) Mouse Tagged ORF Clone
MG223895 10 µg

Galnt3 (NM_015736) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Neuromedin-U receptor 1 NMUR1 Antibody
A09256-1 100 µL

Anti-Neuromedin-U receptor 1 NMUR1 Antibody

Sign In for Pricing
View Details
PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10G2]
TA806575BM 100 µL

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10G2]

Sign In for Pricing
View Details
VIM Antibody (Phospho-Ser56)
OASG07539-100UL 100 µL

VIM Antibody (Phospho-Ser56)

Sign In for Pricing
View Details
TGFB1 ELISA Kit (Sheep)
OKCA01965-96W 96 Well

TGFB1 ELISA Kit (Sheep)

Sign In for Pricing
View Details