Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 53 (Tmem53)

This Recombinant Mouse Transmembrane protein 53 (Tmem53) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Transmembrane protein 53

UniProt

Q9D0Z3

Expression Region

1-276

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAELDYSIEIPDQPCWSQKNRQGGKEAGKQQPVVILLGWGGCRDKNLAKYSAIYHKRG CIVIRYTAPWHMVFFSESLGIPSLRVIAQKLLELLFDYEIEREPLLFHVFSNAGVMLYRY VLELLQTHQRFRHLHVVGTIFDSGPGDSNLIGALRALATILERRPAVLRLLLLAAFALVV ILFHFLLAPFTALFHTHFYDRLQDSGSCWPELYLYSRADKVVSARDVERMVEARLAHQVM VRGVDFVSSAHVSHLRDYPTYYTSLCVDFMHNCVQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPRC Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-2333R-BF750 100 µL

NPRC Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
DBC-1 Polyclonal Antibody
BT-AP02505-01 20 µL

DBC-1 Polyclonal Antibody

Sign In for Pricing
View Details
DBC-1 Polyclonal Antibody
BT-AP02505-02 50 µL

DBC-1 Polyclonal Antibody

Sign In for Pricing
View Details
DBC-1 Polyclonal Antibody
BT-AP02505-03 100 µL

DBC-1 Polyclonal Antibody

Sign In for Pricing
View Details
FZD5 (FZD5, C2orf31, DKFZP434E2135, Frizzled Family Receptor 5, Fz5, Fzd-5, FzE5, Frizzled 5, Frizzled-5, Wnt Receptor, Fz-5, HFZ5)
170513 50 µg

FZD5 (FZD5, C2orf31, DKFZP434E2135, Frizzled Family Receptor 5, Fz5, Fzd-5, FzE5, Frizzled 5, Frizzled-5, Wnt Receptor, Fz-5, HFZ5)

Sign In for Pricing
View Details
Pomolic acid
C18267-25mg 25 mg

Pomolic acid

Sign In for Pricing
View Details