Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 53 (Tmem53)

This Recombinant Mouse Transmembrane protein 53 (Tmem53) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Transmembrane protein 53

UniProt

Q9D0Z3

Expression Region

1-276

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAELDYSIEIPDQPCWSQKNRQGGKEAGKQQPVVILLGWGGCRDKNLAKYSAIYHKRG CIVIRYTAPWHMVFFSESLGIPSLRVIAQKLLELLFDYEIEREPLLFHVFSNAGVMLYRY VLELLQTHQRFRHLHVVGTIFDSGPGDSNLIGALRALATILERRPAVLRLLLLAAFALVV ILFHFLLAPFTALFHTHFYDRLQDSGSCWPELYLYSRADKVVSARDVERMVEARLAHQVM VRGVDFVSSAHVSHLRDYPTYYTSLCVDFMHNCVQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPLC Column, Polar-RP,5μm,120Å,3.0x75mm (The storage temperature is 2-8 degrees Celsius)
13021089 1 PC

HPLC Column, Polar-RP,5μm,120Å,3.0x75mm (The storage temperature is 2-8 degrees Celsius)

Sign In for Pricing
View Details
2-Hydroxy-4-iodobenzoic acid
sc-283164 5 g

2-Hydroxy-4-iodobenzoic acid

Sign In for Pricing
View Details
Recombinant Escherichia coli serB Protein (aa 1-322)
VAng-Lsx02637-50gEcoli 50 µg (E. coli)

Recombinant Escherichia coli serB Protein (aa 1-322)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. DNA mismatch repair protein MutS (mutS), partial
MBS1072033 Inquire

Recombinant Anaeromyxobacter sp. DNA mismatch repair protein MutS (mutS), partial

Sign In for Pricing
View Details
H2-T23 Protein Lysate (Mouse) with C-HA Tag
22941034 100 µg

H2-T23 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
DCLK1 Antibody
orb1284324 100 µL

DCLK1 Antibody

Sign In for Pricing
View Details