Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 178 (tmem178)

This Recombinant Danio rerio Transmembrane protein 178 (tmem178) spans the amino acid sequence from region 26-301.

Product Specifications

Product Name Alternative

Transmembrane protein 178

UniProt

Q08CE6

Expression Region

26-301

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IFTDHWYETDTRRHKENCDQYGSESNDQKNREMPIYHLPLVDSGNAKRNLALMKPIHVGS REEELLENWRAILGMGILETECGRPLFSTYSGLWRKCYFQGMDRDIDKLILKGIAERCTS VKYHFSQPIRLRNIPLNLTRTIQQDEWHLLHLRRITAGFLGMAAAVMLCGSIVAAVGFFW EESLTQHVSGLLFLMAGIFCTISLCTYAASVSYDLSRNPPFIYGLPSDVDHGYGWSIFCA WVSLGLTVASGCICTTYPFLSRTKALRSKTARESSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-100 1x 100 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-100 1x 100 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details