Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein LOC339524

This Recombinant Human Uncharacterized protein LOC339524 spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Uncharacterized protein LOC339524

UniProt

Q6ZW34

Expression Region

1-276

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLARRDLGLVPHGVSGVSIAASSTPQGQAVCSPSVAAPSTLLLLRTHLLGAASLQGCGVL HILPIFLFSKGCRRDAQCACTVGPSASPRSGRGPGRGGGRRPRLGAARSGCPGAAAAGGP AVLHPWRRAGGRVRGASPPQGPQTARGFPLPSRWSSSPIPGCISIYPSPISFAHPGSLAP LGSPFPSPGPPSRSRLLCPGLRRGLTPGRWFRPDLGSLVTPRLLPLPNSGEPGIKPCAFL FFLLRAESTLHVCQGISSESERRTRSFFFFPRSCLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF1 Protein Vector (Rat) (pPB-N-His)
PV304459 500 ng

SF1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
EIF2B2 (Translation Initiation Factor eIF-2B Subunit beta, S20I15, S20III15, eIF-2B GDP-GTP Exchange Factor Subunit beta, EIF2BB) (MaxLight 405) discontinued
126225-ML405 100 µL

EIF2B2 (Translation Initiation Factor eIF-2B Subunit beta, S20I15, S20III15, eIF-2B GDP-GTP Exchange Factor Subunit beta, EIF2BB) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Uzansertib (INCB053914)
S8800-5mg 5 mg

Uzansertib (INCB053914)

Sign In for Pricing
View Details
TRIM45 Polyclonal Antibody
MBS2517644-01 0.02 mL

TRIM45 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM45 Polyclonal Antibody
MBS2517644-02 0.06 mL

TRIM45 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM45 Polyclonal Antibody
MBS2517644-03 0.12 mL

TRIM45 Polyclonal Antibody

Sign In for Pricing
View Details