Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein LOC339524

This Recombinant Human Uncharacterized protein LOC339524 spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Uncharacterized protein LOC339524

UniProt

Q6ZW34

Expression Region

1-276

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLARRDLGLVPHGVSGVSIAASSTPQGQAVCSPSVAAPSTLLLLRTHLLGAASLQGCGVL HILPIFLFSKGCRRDAQCACTVGPSASPRSGRGPGRGGGRRPRLGAARSGCPGAAAAGGP AVLHPWRRAGGRVRGASPPQGPQTARGFPLPSRWSSSPIPGCISIYPSPISFAHPGSLAP LGSPFPSPGPPSRSRLLCPGLRRGLTPGRWFRPDLGSLVTPRLLPLPNSGEPGIKPCAFL FFLLRAESTLHVCQGISSESERRTRSFFFFPRSCLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OlFactory Receptor 5B21 (OR5B21) Human ELISA Kit
F5613 96 Tests

OlFactory Receptor 5B21 (OR5B21) Human ELISA Kit

Sign In for Pricing
View Details
CAPZA3 (F-actin-capping Protein Subunit alpha-3, CapZ alpha-3, CP-alpha-3, Germ Cell-specific Protein 3, CAPAA3, GSG3) (HRP)
MBS6372238-01 0.1 mL

CAPZA3 (F-actin-capping Protein Subunit alpha-3, CapZ alpha-3, CP-alpha-3, Germ Cell-specific Protein 3, CAPAA3, GSG3) (HRP)

Sign In for Pricing
View Details
CAPZA3 (F-actin-capping Protein Subunit alpha-3, CapZ alpha-3, CP-alpha-3, Germ Cell-specific Protein 3, CAPAA3, GSG3) (HRP)
MBS6372238-02 5x 0.1 mL

CAPZA3 (F-actin-capping Protein Subunit alpha-3, CapZ alpha-3, CP-alpha-3, Germ Cell-specific Protein 3, CAPAA3, GSG3) (HRP)

Sign In for Pricing
View Details
CCDC137, CT (CCDC137, Coiled-coil domain-containing protein 137) (APC)
MBS6281509-01 0.2 mL

CCDC137, CT (CCDC137, Coiled-coil domain-containing protein 137) (APC)

Sign In for Pricing
View Details
CCDC137, CT (CCDC137, Coiled-coil domain-containing protein 137) (APC)
MBS6281509-02 5x 0.2 mL

CCDC137, CT (CCDC137, Coiled-coil domain-containing protein 137) (APC)

Sign In for Pricing
View Details
Phospho-LATS1+LATS2 (Thr1079 +Thr1041) Antibody Blocking Peptide
orb1501686 500 µg

Phospho-LATS1+LATS2 (Thr1079 +Thr1041) Antibody Blocking Peptide

Sign In for Pricing
View Details