Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein LOC339524

This Recombinant Human Uncharacterized protein LOC339524 spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Uncharacterized protein LOC339524

UniProt

Q6ZW34

Expression Region

1-276

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLARRDLGLVPHGVSGVSIAASSTPQGQAVCSPSVAAPSTLLLLRTHLLGAASLQGCGVL HILPIFLFSKGCRRDAQCACTVGPSASPRSGRGPGRGGGRRPRLGAARSGCPGAAAAGGP AVLHPWRRAGGRVRGASPPQGPQTARGFPLPSRWSSSPIPGCISIYPSPISFAHPGSLAP LGSPFPSPGPPSRSRLLCPGLRRGLTPGRWFRPDLGSLVTPRLLPLPNSGEPGIKPCAFL FFLLRAESTLHVCQGISSESERRTRSFFFFPRSCLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-[2-Fluoro-6- (morpholin-4-yl) phenyl]ethan-1-ol
GWB52132-01 50 mg

1-[2-Fluoro-6- (morpholin-4-yl) phenyl]ethan-1-ol

Sign In for Pricing
View Details
1-[2-Fluoro-6- (morpholin-4-yl) phenyl]ethan-1-ol
GWB52132-02 0.5 g

1-[2-Fluoro-6- (morpholin-4-yl) phenyl]ethan-1-ol

Sign In for Pricing
View Details
Anti-Endothelin B Receptor/EDNRB Antibody Picoband® (Dylight488 Conjugate)
PB9554-Dylight488 100 µg

Anti-Endothelin B Receptor/EDNRB Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
TRPM4 Polyclonal Conjugated Antibody
orb1628885 100 µL

TRPM4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Anti-ANXA1/Annexin A1 Antibody (R2Y52)
RHC06203 100 μg

Anti-ANXA1/Annexin A1 Antibody (R2Y52)

Sign In for Pricing
View Details
Human GABRB1 Pre-designed siRNA Set B
SI005997B 1 Each

Human GABRB1 Pre-designed siRNA Set B

Sign In for Pricing
View Details