Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6B Virion egress protein U34 (U34)

This Recombinant Human herpesvirus 6B Virion egress protein U34 (U34) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Virion egress protein U34, Primary envelopment factor U34

UniProt

Q9QJ35

Expression Region

1-276

Origin

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANVLKEKMYDELLSATCRILKLGSHDYRMTERNLLSKNPKFPLCDIILKLDYAYNLEYL LSLWEHVTKQEPRFVFKNTGGAVSMSCYLHAPVKAEGHHAVRECNILRVNECLTVRMSDI VAMKPSTFAVFTKCIIRRNRDETYVVEFVAFGPENESEYISLLKAIFLKKCSMGKQHLES NRFCQGLRRRSSHVLEKGQLGSSGEIANKASAVVTSQESINQFYEKEKSFLSGVKFSRLS ERHCRVAIVSICFLLALYFCYVLLKKTPTPASGPVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF647 conjugate, 0.1mg/mL
BNC470164-100 1x 100 µL

CD28 (204.12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details