Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 53 (TMEM53)

This Recombinant Human Transmembrane protein 53 (TMEM53) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Transmembrane protein 53

UniProt

Q6P2H8

Expression Region

1-277

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKNLAKYSAIYHK RGCIVIRYTAPWHMVFFSESLGIPSLRVLAQKLLELLFDYEIEKEPLLFHVFSNGGVMLY RYVLELLQTRRFCRLRVVGTIFDSAPGDSNLVGALRALAAILERRAAMLRLLLLVAFALV VVLFHVLLAPITALFHTHFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRV LARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acid Phosphatase Microplate Assay Kit
RDSM001 100 Assays

Acid Phosphatase Microplate Assay Kit

Sign In for Pricing
View Details
Cortactin Recombinant Rabbit Monoclonal Antibody [SC61-08]
ET1610-87 100 µL

Cortactin Recombinant Rabbit Monoclonal Antibody [SC61-08]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Soft tissue
CB602760 1 Block

Frozen Tissue Blocks, Soft tissue

Sign In for Pricing
View Details
Integrin beta 5 (ITGB5) Human Gene Knockout Kit (CRISPR)
KN400731 1 Kit

Integrin beta 5 (ITGB5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Amino-4H-1,2,4-triazole-3-carboxylic Acid
TRC-A630700-2.5G 2.5 g

5-Amino-4H-1,2,4-triazole-3-carboxylic Acid

Sign In for Pricing
View Details
VMA21 Polyclonal Antibody
E-AB-53204-01 20 µL

VMA21 Polyclonal Antibody

Sign In for Pricing
View Details