Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 53 (TMEM53)

This Recombinant Human Transmembrane protein 53 (TMEM53) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Transmembrane protein 53

UniProt

Q6P2H8

Expression Region

1-277

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKNLAKYSAIYHK RGCIVIRYTAPWHMVFFSESLGIPSLRVLAQKLLELLFDYEIEKEPLLFHVFSNGGVMLY RYVLELLQTRRFCRLRVVGTIFDSAPGDSNLVGALRALAAILERRAAMLRLLLLVAFALV VVLFHVLLAPITALFHTHFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRV LARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: TB28-2]
AM26044RP-N 100 Tests

Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: TB28-2]

Sign In for Pricing
View Details
EVA1C Human Gene Knockout Kit (CRISPR)
KN424827 1 Kit

EVA1C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Alox12e activation kit by CRISPRa
GA200166 1 Kit

Mouse Alox12e activation kit by CRISPRa

Sign In for Pricing
View Details
4-(2-Ethoxy-2-oxoethoxy)phenylboronic Acid
TRC-E892543-500MG 500 mg

4-(2-Ethoxy-2-oxoethoxy)phenylboronic Acid

Sign In for Pricing
View Details
Prune2 Mouse Gene Knockout Kit (CRISPR)
KN514061 1 Kit

Prune2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF594 conjugate, 0.1mg/mL
BNC942026-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details