Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 53 (TMEM53)

This Recombinant Human Transmembrane protein 53 (TMEM53) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Transmembrane protein 53

UniProt

Q6P2H8

Expression Region

1-277

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKNLAKYSAIYHK RGCIVIRYTAPWHMVFFSESLGIPSLRVLAQKLLELLFDYEIEKEPLLFHVFSNGGVMLY RYVLELLQTRRFCRLRVVGTIFDSAPGDSNLVGALRALAAILERRAAMLRLLLLVAFALV VVLFHVLLAPITALFHTHFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRV LARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pumilio 2 Recombinant Rabbit Monoclonal Antibody [JE37-76]
HA721486 100 µL

Pumilio 2 Recombinant Rabbit Monoclonal Antibody [JE37-76]

Sign In for Pricing
View Details
Tissue FFPE Sections, Artery: carotid
CS702944 5x 5 µm

Tissue FFPE Sections, Artery: carotid

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF594 conjugate, 0.1mg/mL
BNC941462-100 1x 100 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Metamizol Sodium Monohydrate
TRC-M244740-250MG 250 mg

Metamizol Sodium Monohydrate

Sign In for Pricing
View Details
Recombinant IKK alpha Antibody
RC-6951-01 50 μL

Recombinant IKK alpha Antibody

Sign In for Pricing
View Details
Recombinant IKK alpha Antibody
RC-6951-02 100 µL

Recombinant IKK alpha Antibody

Sign In for Pricing
View Details