Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 55B (TMEM55B)

This Recombinant Human Transmembrane protein 55B (TMEM55B) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Transmembrane protein 55B, EC= 3.1.3.78, PtdIns-4,5-P2 4-Ptase I, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase

UniProt

Q86T03

Expression Region

1-277

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVL PGEDPPPYSPLTSPDSGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGK KYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVICGHCKNT FLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGTWKHARRY GGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Aminoacylase 1 (ACY1)
TRV-0041233-01 24 Tests

ELISA Kit for Aminoacylase 1 (ACY1)

Sign In for Pricing
View Details
ELISA Kit for Aminoacylase 1 (ACY1)
TRV-0041233-02 48 Tests

ELISA Kit for Aminoacylase 1 (ACY1)

Sign In for Pricing
View Details
ELISA Kit for Aminoacylase 1 (ACY1)
TRV-0041233-03 96 Tests

ELISA Kit for Aminoacylase 1 (ACY1)

Sign In for Pricing
View Details
ELISA Kit for Aminoacylase 1 (ACY1)
TRV-0041233-04 5x 96 Tests

ELISA Kit for Aminoacylase 1 (ACY1)

Sign In for Pricing
View Details
ELISA Kit for Aminoacylase 1 (ACY1)
TRV-0041233-05 10x 96 Tests

ELISA Kit for Aminoacylase 1 (ACY1)

Sign In for Pricing
View Details
Nori® Human 14-3-3 theta ELISA Kit
GR111215 96 Well

Nori® Human 14-3-3 theta ELISA Kit

Sign In for Pricing
View Details