Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 55B (TMEM55B)

This Recombinant Human Transmembrane protein 55B (TMEM55B) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Transmembrane protein 55B, EC= 3.1.3.78, PtdIns-4,5-P2 4-Ptase I, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase

UniProt

Q86T03

Expression Region

1-277

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVL PGEDPPPYSPLTSPDSGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGK KYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVICGHCKNT FLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGTWKHARRY GGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAFB Rabbit Polyclonal Antibody (BF488)
orb2491699 100 µL

SAFB Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
ATE1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62759R-BF405 100 µL

ATE1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Anti-Livin/BIRC7 Antibody Picoband® (iFluor647 Conjugate)
RP1081-iFluor647 100 µg

Anti-Livin/BIRC7 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Bar Magnets, Alnico
1070040/17 1 Each

Bar Magnets, Alnico

Sign In for Pricing
View Details
DGK iota Antibody
abx141028-01 30 µL

DGK iota Antibody

Sign In for Pricing
View Details
DGK iota Antibody
abx141028-02 100 µL

DGK iota Antibody

Sign In for Pricing
View Details