Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostasin (PRSS8)

This Recombinant Human Prostasin (PRSS8) spans the amino acid sequence from region 45-322.

Product Specifications

Product Name Alternative

Prostasin, EC= 3.4.21.-, Serine protease 8, Cleaved into the following 2 chains:, 1. Prostasin light chain, 2. Prostasin heavy chain

UniProt

Q16651

Expression Region

45-322

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQ LDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPN GLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCA GYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSK VTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF2 Polyclonal Antibody
E-AB-15525-01 20 µL

FGF2 Polyclonal Antibody

Sign In for Pricing
View Details
FGF2 Polyclonal Antibody
E-AB-15525-02 60 µL

FGF2 Polyclonal Antibody

Sign In for Pricing
View Details
FGF2 Polyclonal Antibody
E-AB-15525-03 120 µL

FGF2 Polyclonal Antibody

Sign In for Pricing
View Details
FGF2 Polyclonal Antibody
E-AB-15525-04 200 µL

FGF2 Polyclonal Antibody

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF405S conjugate, 0.1mg/mL
BNC042750-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
8-Bromoguanosine
TRC-B684365-2G 2 g

8-Bromoguanosine

Sign In for Pricing
View Details