Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostasin (PRSS8)

This Recombinant Human Prostasin (PRSS8) spans the amino acid sequence from region 45-322.

Product Specifications

Product Name Alternative

Prostasin, EC= 3.4.21.-, Serine protease 8, Cleaved into the following 2 chains:, 1. Prostasin light chain, 2. Prostasin heavy chain

UniProt

Q16651

Expression Region

45-322

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQ LDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPN GLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCA GYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSK VTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PeacockTM Plus Prestained Protein Marker
#21531-50uL 1x 50 µL

PeacockTM Plus Prestained Protein Marker

Sign In for Pricing
View Details
DPM1 (NM_003859) Human Over-expression Lysate
LC401268 20 µg

DPM1 (NM_003859) Human Over-expression Lysate

Sign In for Pricing
View Details
HCG3 (DNAJB3) Human Gene Knockout Kit (CRISPR)
KN205526BN 1 Kit

HCG3 (DNAJB3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FGF10 (C-term) Rabbit Polyclonal Antibody
AP51653PU-N 400 µL

FGF10 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRIM72 Antibody
KC-18299-01 50 μL

TRIM72 Antibody

Sign In for Pricing
View Details
TRIM72 Antibody
KC-18299-02 100 µL

TRIM72 Antibody

Sign In for Pricing
View Details