Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Translocation protein SEC62 (SEC62)

This Recombinant Debaryomyces hansenii Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Translocation protein SEC62

UniProt

Q6BI99

Expression Region

1-278

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEVPITTSNQRSQVAINIANYLKDNKILKQRTGLLNNSEDVEFFRYKRLARALLSDDYK TKQANHKNGLIPIADEQEAAKVFITLIQSQFVIPVEKLHYNEIKQANKSWKPNKTKPTLK QSTKANIEPNAYFVWTYNKPNPFILLYSILLLVGIFTIILFPLWPNFMKIGVWYLSMGLL GLLGLFFLIAIIRLIIYIITLLVLPRAFWLYPNLFEDCGVLESFQPLYGWDEPKKSKKGK SSKSASKPETESSGAATGVKPAENAPTKRKVVLEEVDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpress™ Human BTBD8 Over-expressing Stable Cell Line
ABC-X0318 1 Vial

Xpress™ Human BTBD8 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Anti-Nestin
orb1129204 100 µL

Anti-Nestin

Sign In for Pricing
View Details
Rat nicotinic acetylcholine receptor, N-AChR ELISA Kit
SL0528Ra-01 48 Tests

Rat nicotinic acetylcholine receptor, N-AChR ELISA Kit

Sign In for Pricing
View Details
Rat nicotinic acetylcholine receptor, N-AChR ELISA Kit
SL0528Ra-02 96 Tests

Rat nicotinic acetylcholine receptor, N-AChR ELISA Kit

Sign In for Pricing
View Details
Olfr830 siRNA (m)
sc-151168 10 µM

Olfr830 siRNA (m)

Sign In for Pricing
View Details
IgG Antibody
orb435745 5 mg

IgG Antibody

Sign In for Pricing
View Details