Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Translocation protein SEC62 (SEC62)

This Recombinant Debaryomyces hansenii Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Translocation protein SEC62

UniProt

Q6BI99

Expression Region

1-278

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEVPITTSNQRSQVAINIANYLKDNKILKQRTGLLNNSEDVEFFRYKRLARALLSDDYK TKQANHKNGLIPIADEQEAAKVFITLIQSQFVIPVEKLHYNEIKQANKSWKPNKTKPTLK QSTKANIEPNAYFVWTYNKPNPFILLYSILLLVGIFTIILFPLWPNFMKIGVWYLSMGLL GLLGLFFLIAIIRLIIYIITLLVLPRAFWLYPNLFEDCGVLESFQPLYGWDEPKKSKKGK SSKSASKPETESSGAATGVKPAENAPTKRKVVLEEVDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1228081-01 0.02 mg (E-Coli)

Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1228081-02 0.1 mg (E-Coli)

Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1228081-03 0.02 mg (Yeast)

Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1228081-04 0.1 mg (Yeast)

Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1228081-05 0.02 mg (Baculovirus)

Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1228081-06 0.02 mg (Mammalian-Cell)

Recombinant Wolbachia sp. subsp. Drosophila simulans DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details