Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydomonas reinhardtii Chlorophyll a-b binding protein CP29 (Lhcb4)

This Recombinant Chlamydomonas reinhardtii Chlorophyll a-b binding protein CP29 (Lhcb4) spans the amino acid sequence from region 2-280.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein CP29, Lhcbm4

UniProt

Q93WD2

Expression Region

2-280

Origin

Chlamydomonas reinhardtii (Chlamydomonas smithii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VFKFPTPPGTQKKAGTTATKPAPKATTKKVATSTGTRSGGVGYRKYQGDALWLPNTTRPE WLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNAAKNNKGSVEAIVQATPDEVSSENRL APYSEVFGLARFRECELIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYAGLSLP FSITQLIWIEVILVGGAEFYRNSETNPEKRCYPGGVFDPLKLASEDEERAFRLKTAEIKH ARLAMVSFFGYGVQALSTGEGALGSLAKFADGLNNGKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-500 1x 500 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-500 1x 500 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF488A conjugate, 0.1mg/mL
BNC881532-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details