Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudoalteromonas phage PM2 Uncharacterized protein Gp-j (j)

This Recombinant Pseudoalteromonas phage PM2 Uncharacterized protein Gp-j (j) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Uncharacterized protein Gp-j

UniProt

Q9XJR4

Expression Region

1-279

Origin

Pseudoalteromonas phage PM2 (Bacteriophage PM2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLFGGGNSKSTSNQTTNNENTNIATQGDNLGAVINGNGNSVTMTDHGLVDALVDIGGYM SDSTQAAFGAASDMAYSSTEFAGQAITDGFDYAEGVNRDSLDMAEGINRDSLNFGRDALS VTGDLMTDAMQYSSDAMLASIEGNAGLAGQVMDASTTMTGQSLNFGLDTFSGAMDSLNQS NNNMALLAEFTSNQSTDLARDSMAFGADLMAQYQDNISASNYDAREHMLDASKTAMQFAD NMSRSDGQQLAKDSNKTLMIGIVAVSAAVGLYAISKGVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOT9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0030405 3x 1.0 µg

ACOT9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester
292673-01 5 mg

O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester

Sign In for Pricing
View Details
O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester
292673-02 10 mg

O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester

Sign In for Pricing
View Details
O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester
292673-03 25 mg

O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester

Sign In for Pricing
View Details
O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester
292673-04 50 mg

O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester

Sign In for Pricing
View Details
O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester
292673-05 100 mg

O- (2-Azido-4,6-O-benzylidene-2-deoxy-a-D-galactopyranosyl) -N-[ (9H-fluoren-9-ylmethoxy) carbonyl]-L-threonine tert-Butyl Ester

Sign In for Pricing
View Details