Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yobJ (yobJ)

This Recombinant Bacillus subtilis Uncharacterized protein yobJ (yobJ) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Uncharacterized protein yobJ

UniProt

O34774

Expression Region

1-280

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELLDIWNWIQQNGILTAVITGIVALLFNQRQKSIERFYSQSGETLEKILEPMYYSLKEI KNEEDENHKMVLIEKFFEEYSGKKGKLSKLRNILLIDQILNTEDCFREYILNKNSENRKK LFYKMRMLDQAVNKEYRSIFVTLNKNYNWYKVLFRTNYILSAVFVFVRWFKETLAFFVGA SAFAFIPLLYDKYLGEQVLGNWLEVNKLIFGLSCSALYIFWIIHYFLLKDTMQRKDEISL FQEWFDKTKLGKWTNKNVWGKIGNWNVERRARRVRNDEDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TFR2 Protein, N-His
orb3060246-01 50 µg

Recombinant Human TFR2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TFR2 Protein, N-His
orb3060246-02 100 µg

Recombinant Human TFR2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TFR2 Protein, N-His
orb3060246-03 1 mg

Recombinant Human TFR2 Protein, N-His

Sign In for Pricing
View Details
Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (MaxLight 550)
130091-ML550 100 µL

Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (MaxLight 550)

Sign In for Pricing
View Details
SYCP3 (Synaptonemal Complex Protein 3, SCP-3, SYCP3, SCP3) (MaxLight 550) discontinued
302780-ML550 100 µL

SYCP3 (Synaptonemal Complex Protein 3, SCP-3, SYCP3, SCP3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
8-[ (6-Amino) hexyl]-amino-ATP – 6-FAM
JBS-NU-807-6FM 160 μL

8-[ (6-Amino) hexyl]-amino-ATP – 6-FAM

Sign In for Pricing
View Details