Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Stomatin-4 (sto-4)

This Recombinant Stomatin-4 (sto-4) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Stomatin-4

UniProt

Q22165

Expression Region

1-281

Origin

Caenorhabditis elegans

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRQGTVRAPCSRIVDPHQKVNYTVCGWIITIISYLVVLFTLPLSAFFCLKVVQEYERAV IFRLGRLKHGGARGPGIFFIIPCIESFKKIDLRVVSFDVPPQEILSKDSVTVSVDAVIYF RISNATVSVINVEDAARSTKLLAQTTLRNFLGTRTLAEMLSSRDAISMQMQAALDEATDP WGVKVERVEIKDVRLPIQLQRAMAAEAEAARAAGAKIIAAEGEQLASRALADAADVIATS PCAIQLRYLQTLNSISSEKNNTIIFPFPTELIAKFIQSAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2-Aminoethyl) -6-chloropyrazin-2-amine
NVB22048-01 50 mg

N- (2-Aminoethyl) -6-chloropyrazin-2-amine

Sign In for Pricing
View Details
N- (2-Aminoethyl) -6-chloropyrazin-2-amine
NVB22048-02 0.5 g

N- (2-Aminoethyl) -6-chloropyrazin-2-amine

Sign In for Pricing
View Details
Biotin Anti-Mouse CD25 (PC61.5)
MBS4165344-01 0.1 mg

Biotin Anti-Mouse CD25 (PC61.5)

Sign In for Pricing
View Details
Biotin Anti-Mouse CD25 (PC61.5)
MBS4165344-02 5x 0.1 mg

Biotin Anti-Mouse CD25 (PC61.5)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Latexin (LXN)
MBS2096477-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Latexin (LXN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Latexin (LXN)
MBS2096477-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Latexin (LXN)

Sign In for Pricing
View Details