Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Stomatin-4 (sto-4)

This Recombinant Stomatin-4 (sto-4) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Stomatin-4

UniProt

Q22165

Expression Region

1-281

Origin

Caenorhabditis elegans

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRQGTVRAPCSRIVDPHQKVNYTVCGWIITIISYLVVLFTLPLSAFFCLKVVQEYERAV IFRLGRLKHGGARGPGIFFIIPCIESFKKIDLRVVSFDVPPQEILSKDSVTVSVDAVIYF RISNATVSVINVEDAARSTKLLAQTTLRNFLGTRTLAEMLSSRDAISMQMQAALDEATDP WGVKVERVEIKDVRLPIQLQRAMAAEAEAARAAGAKIIAAEGEQLASRALADAADVIATS PCAIQLRYLQTLNSISSEKNNTIIFPFPTELIAKFIQSAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LYZL1 Antibody
NBP2-41184 0.1 mg

Rabbit Polyclonal LYZL1 Antibody

Sign In for Pricing
View Details
Fibronectin Monoclonal Antibody
OABB00100-100UG 100 µg/Vial

Fibronectin Monoclonal Antibody

Sign In for Pricing
View Details
MIR4690 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV769921 1.0 µg DNA

MIR4690 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
OPTC Antibody Blocking Peptide
orb1508106 500 µg

OPTC Antibody Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human NOL10 Protein
E30P03845B 50 µg

Recombinant Human NOL10 Protein

Sign In for Pricing
View Details
NMDAR2C (Ser1244) Antibody
252566 0.1 mL

NMDAR2C (Ser1244) Antibody

Sign In for Pricing
View Details