Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein ARV1 (ARV1)

This Recombinant Bovine Protein ARV1 (ARV1) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Protein ARV1

UniProt

Q3SZW3

Expression Region

1-282

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTGGQNGLRPGKGNTEGVKEGKGKTDEVTMTSNTDASASCQYRCIECNQEAKELYRDYN HGVLKITICKSCQKPVDKYIEYDPVIILINAILCKAQAYRHILFNTKINMHGKLCVFCLL CEAYLRWWQLQDSSQSIDPDDFIRYAKEWDFYRMFAIASLEQTAYFIGIFAFLWVERPIR AKEKLNFTLLLKALLLSSYGKLLLIPAVIWEHDYTPLCLRLIKVFVLTSNFQAIRVTLNI NRKLAFLAILSGLLVESTMVYFFQRMEWAVGSDCAIYKSQDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human POU6F2 Pre-designed siRNA Set B
SI012595B 1 Each

Human POU6F2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MID1IP1 Antibody (N-term)
orb30785-01 50 µL

MID1IP1 Antibody (N-term)

Sign In for Pricing
View Details
MID1IP1 Antibody (N-term)
orb30785-02 100 µL

MID1IP1 Antibody (N-term)

Sign In for Pricing
View Details
Lentiviral human GDNF shRNA (UAS) - Lentiviral human GDNF shRNA (UAS, iRFP) plasmid
GTR15085564 1 Vial

Lentiviral human GDNF shRNA (UAS) - Lentiviral human GDNF shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
G6PD Antibody, HRP conjugated
MBS7046188-01 0.05 mg

G6PD Antibody, HRP conjugated

Sign In for Pricing
View Details
G6PD Antibody, HRP conjugated
MBS7046188-02 0.1 mg

G6PD Antibody, HRP conjugated

Sign In for Pricing
View Details