Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apocytochrome f (petA)

This Recombinant Apocytochrome f (petA) spans the amino acid sequence from region 32-313.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q9MUN6

Expression Region

32-313

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPIFAQQNYASPREATGRIVCANCHLAKKPVDIEVPQAVLPDTVFEAVVKIPYDTQVQQV LGNGKKGPLNVGAVLILPEGFKLAPQDRIPEEMKSKISNLYFQPYNAANENILVIGPIPG DKNREIVFPILSPDPAKDKGTYFIKYPISVGANRGRGQVYPDGSKSNNTVYNASVSGTIT DIIKEKKAYKISIETKDGTVVDTVPVGPELIVAKGDTVVTGQPITDNPNVGGFGQMDTEV VLQNPVRIKWLIAFLILSTLGQVFLVLKKKQFERVQIAESNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details