Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human adenovirus C serotype 2 Early 31 kDa protein

This Recombinant Human adenovirus C serotype 2 Early 31 kDa protein spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Early 31 kDa protein

UniProt

P03242

Expression Region

1-283

Origin

Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLSLRLRVCIPPGYF GRFLALTDVNQPDVFTESYIMTPDMTEELSVVLFNHGDQFFYGHAGMAVVRLMLIRVVFP VEPADMFERKMVSFSVVVPELTCLYLHEHDYDVLAFLREALPDFLSSTLHFISPPMQQAY IGATLVSIAPSMRVIISVGSFVMVPGGEVAALVRADLHDYVQLALRRDLRDRGIFVNVPL LNLIQVCEEPEFLQSLGIAYLLLRQRPALPYWRIIRCCPNVTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-100 1x 100 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF488A conjugate, 0.1mg/mL
BNC882096-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), CF640R conjugate, 0.1mg/mL
BNC400639-100 1x 100 µL

CD31 / PECAM-1 (JC/70A), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details