Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A2BVC3

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9515)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQAVGADSVFKAVVKIPYKDDIKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGVYFTNYSEEKENIIIVGPLPG DTNKEIIFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVIFTSSSAGTIN SIETIEDGSYQINIENENGEITTEAVPVGPKLIVKEQDQITVGAPLTSDPNVGGFGQLDA EVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC8 (NM_001185024) Human Over-expression Lysate
LY433491 100 µg

ZDHHC8 (NM_001185024) Human Over-expression Lysate

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF568 conjugate, 0.1mg/mL
BNC682063-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAP3K5 Antibody
KC-1340-01 50 μL

MAP3K5 Antibody

Sign In for Pricing
View Details
MAP3K5 Antibody
KC-1340-02 100 µL

MAP3K5 Antibody

Sign In for Pricing
View Details
MAP3K5 Antibody
KC-1340-03 1 mL

MAP3K5 Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike NTD Protein (C136F, Y144del, R190S, D215G, LA242-243del), His Tag (MALS verified)
SPD-C5229-1mg 1 mg

SARS-CoV-2 Spike NTD Protein (C136F, Y144del, R190S, D215G, LA242-243del), His Tag (MALS verified)

Sign In for Pricing
View Details