Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A2BVC3

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9515)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQAVGADSVFKAVVKIPYKDDIKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGVYFTNYSEEKENIIIVGPLPG DTNKEIIFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVIFTSSSAGTIN SIETIEDGSYQINIENENGEITTEAVPVGPKLIVKEQDQITVGAPLTSDPNVGGFGQLDA EVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplite® Colorimetric Superoxide Dismutase (SOD) Assay Kit
11305-AAT 200 Tests

Amplite® Colorimetric Superoxide Dismutase (SOD) Assay Kit

Sign In for Pricing
View Details
LHX3 Recombinant Rabbit Monoclonal Antibody [JE37-44]
HA722334 100 µL

LHX3 Recombinant Rabbit Monoclonal Antibody [JE37-44]

Sign In for Pricing
View Details
Vmn1r74 Mouse Gene Knockout Kit (CRISPR)
KN519090 1 Kit

Vmn1r74 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), CF740 conjugate, 0.1mg/mL
BNC742353-100 1x 100 µL

Calcineurin A / PPP3CA (CALNA/2353), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdc14b Mouse Gene Knockout Kit (CRISPR)
KN502960 1 Kit

Cdc14b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EASYStep Pro Rabbit Cortisol (Cor) ELISA Kit
RDEp-Cor-Rb 96 Tests

EASYStep Pro Rabbit Cortisol (Cor) ELISA Kit

Sign In for Pricing
View Details