Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A2BPU4

Expression Region

35-317

Origin

Prochlorococcus marinus (strain AS9601)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGVYFTNYSEEQDNIIIVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTAGTIN SIETIEDGSYQVNIENDNGEITTEAVPVGPQLIVKAQDKINVGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GM CSF Receptor alpha (CSF2RA) Mouse Monoclonal Antibody [Clone ID: 4H1]
AM20017RP-N 100 Tests

GM CSF Receptor alpha (CSF2RA) Mouse Monoclonal Antibody [Clone ID: 4H1]

Sign In for Pricing
View Details
MEF2A Rabbit Polyclonal Antibody
AP06372PU-N 100 µg

MEF2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Taxine (mixture of Taxine B and iso-Taxine B) (~80%)
TRC-T100085-10MG 10 mg

Taxine (mixture of Taxine B and iso-Taxine B) (~80%)

Sign In for Pricing
View Details
(-)-Riboflavin
TRC-R414995-25G 25 g

(-)-Riboflavin

Sign In for Pricing
View Details
Human MIP-3α Antibody Pair Set
E-KAB-0703 50 µL & 100 µg

Human MIP-3α Antibody Pair Set

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS801106 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details