Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A2BPU4

Expression Region

35-317

Origin

Prochlorococcus marinus (strain AS9601)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGVYFTNYSEEQDNIIIVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTAGTIN SIETIEDGSYQVNIENDNGEITTEAVPVGPQLIVKAQDKINVGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Renal pelvis
CS500134 5x 5 µm

Frozen Tissue Sections, Renal pelvis

Sign In for Pricing
View Details
AMBP Antibody
KC-381-01 50 μL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-381-02 100 µL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-381-03 1 mL

AMBP Antibody

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), 0.2mg/mL
BNUB3056-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3056), 0.2mg/mL

Sign In for Pricing
View Details
2-Phenylbutyric Acid
TRC-P319600-1G 1 g

2-Phenylbutyric Acid

Sign In for Pricing
View Details