Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 39-321.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A2C0R8

Expression Region

39-321

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQKFENPREATGKIVCANCHVASMPTRAEVPQAVAADSVFKTVVEIPYKKDLQEI GADGSKVPLQVGAVVMLPDGFKLAPQERWTDEIKEETQGVYFTQYSEEQENIILVGPLPG DQNREIVFPVLSPDPRKDSNYNFGKYSIHVGGNRGRGQVYPTGEKSNNNLFTATNSGTIT SIETNEDGTQIINLNNEEGESFTENLPAGTSLLIKEGDTIEKGAKLTEDPNVGGFGQLDK EIVLQSKARVIGMIIFFIGVGLSQIMLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST14 siRNA (Mouse)
orb1846033-01 15 nmol

ST14 siRNA (Mouse)

Sign In for Pricing
View Details
ST14 siRNA (Mouse)
orb1846033-02 30 nmol

ST14 siRNA (Mouse)

Sign In for Pricing
View Details
Recombinant Human Golgin subfamily A member 8Q (GOG8Q), Biotinylated
orb3007950-01 20 µg

Recombinant Human Golgin subfamily A member 8Q (GOG8Q), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Golgin subfamily A member 8Q (GOG8Q), Biotinylated
orb3007950-02 100 µg

Recombinant Human Golgin subfamily A member 8Q (GOG8Q), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Golgin subfamily A member 8Q (GOG8Q), Biotinylated
orb3007950-03 1 mg

Recombinant Human Golgin subfamily A member 8Q (GOG8Q), Biotinylated

Sign In for Pricing
View Details
CD79a Rabbit Polyclonal Antibody
orb666228-01 30 µL

CD79a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details