Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 39-321.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A2C0R8

Expression Region

39-321

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQKFENPREATGKIVCANCHVASMPTRAEVPQAVAADSVFKTVVEIPYKKDLQEI GADGSKVPLQVGAVVMLPDGFKLAPQERWTDEIKEETQGVYFTQYSEEQENIILVGPLPG DQNREIVFPVLSPDPRKDSNYNFGKYSIHVGGNRGRGQVYPTGEKSNNNLFTATNSGTIT SIETNEDGTQIINLNNEEGESFTENLPAGTSLLIKEGDTIEKGAKLTEDPNVGGFGQLDK EIVLQSKARVIGMIIFFIGVGLSQIMLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPOA Rabbit pAb
orb2711328-01 50 µL

PAPOA Rabbit pAb

Sign In for Pricing
View Details
PAPOA Rabbit pAb
orb2711328-02 100 µL

PAPOA Rabbit pAb

Sign In for Pricing
View Details
DGCR8 Protein Vector (Human) (pPM-C-His)
PV012272 500 ng

DGCR8 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
TSH Receptor Antibody (beta chain)
V3432SAF-100UG 100 µg

TSH Receptor Antibody (beta chain)

Sign In for Pricing
View Details
STBD1 (Starch-binding Domain-containing Protein 1, Genethonin-1, GENX-3414, FLJ41801)
MBS648091-01 0.1 mg

STBD1 (Starch-binding Domain-containing Protein 1, Genethonin-1, GENX-3414, FLJ41801)

Sign In for Pricing
View Details
STBD1 (Starch-binding Domain-containing Protein 1, Genethonin-1, GENX-3414, FLJ41801)
MBS648091-02 5x 0.1 mg

STBD1 (Starch-binding Domain-containing Protein 1, Genethonin-1, GENX-3414, FLJ41801)

Sign In for Pricing
View Details