Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A3PBI4

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKKETEGVYFTNYSEEKDNIIVVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSSSGTIN SIETIEDGSYKVNIEKENGEITTEAVPVGPQLIVKAQDKINAGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THOC4 sgRNA CRISPR Lentivector (Human) (Target 3)
K2370304 1.0 µg DNA

THOC4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
NMDAR2B (GRIN2B) Mouse Monoclonal Antibody [Clone ID: S59-36]
TA309448 100 µg

NMDAR2B (GRIN2B) Mouse Monoclonal Antibody [Clone ID: S59-36]

Sign In for Pricing
View Details
ZNF134 (Zinc Finger Protein 134)
496187 100 µL

ZNF134 (Zinc Finger Protein 134)

Sign In for Pricing
View Details
ARL3 siRNA (Human)
MBS8210035-01 15 nmol

ARL3 siRNA (Human)

Sign In for Pricing
View Details
ARL3 siRNA (Human)
MBS8210035-02 30 nmol

ARL3 siRNA (Human)

Sign In for Pricing
View Details
ARL3 siRNA (Human)
MBS8210035-03 5x 30 nmol

ARL3 siRNA (Human)

Sign In for Pricing
View Details