Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A3PBI4

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKKETEGVYFTNYSEEKDNIIVVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSSSGTIN SIETIEDGSYKVNIEKENGEITTEAVPVGPQLIVKAQDKINAGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTF1, ID (UTF1, Undifferentiated embryonic cell transcription factor 1) (Azide free) (HRP) discontinued
043682-HRP 200 µL

UTF1, ID (UTF1, Undifferentiated embryonic cell transcription factor 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Olr855 Protein Vector (Rat) (pPB-N-His)
PV291391 500 ng

Olr855 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
GENLISA™ Human Electron Transfer Flavoprotein Beta Polypeptide (ETFb) ELISA
KBH1411 1x 96 Well

GENLISA™ Human Electron Transfer Flavoprotein Beta Polypeptide (ETFb) ELISA

Sign In for Pricing
View Details
Lad1 (NM_133664) Mouse Recombinant Protein
PM45823M5 20 µg

Lad1 (NM_133664) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse Monocyte Chemotactic Protein-5 (CCL12)
7-01981 5 µg

Recombinant Mouse Monocyte Chemotactic Protein-5 (CCL12)

Sign In for Pricing
View Details
FAM190A (CCSER1) (NM_001145065) Human Tagged ORF Clone Lentiviral Particle
RC226617L3V 200 µL

FAM190A (CCSER1) (NM_001145065) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details