Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A3PBI4

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKKETEGVYFTNYSEEKDNIIVVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSSSGTIN SIETIEDGSYKVNIEKENGEITTEAVPVGPQLIVKAQDKINAGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL13 protein, C-hFc tag
IMP-785 10 µg

Recombinant Human IL13 protein, C-hFc tag

Sign In for Pricing
View Details
KAT8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4745405 3x 1.0 µg

KAT8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. syringae Protein-export membrane protein SecG (secG), partial
MBS7058783 Inquire

Recombinant Pseudomonas syringae pv. syringae Protein-export membrane protein SecG (secG), partial

Sign In for Pricing
View Details
LentimiRa-hsa-miR-4703-3p Vector
mh41954 500 ng

LentimiRa-hsa-miR-4703-3p Vector

Sign In for Pricing
View Details
TMPRSS11F Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
47142064 1.0 µg DNA

TMPRSS11F Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FeTPPS
2065-100 100 mg

FeTPPS

Sign In for Pricing
View Details