Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A8G3H6

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGVYFTNYSEEKENIIIVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTSGTID SIDIIEDGSYKVNIENDNGEITTEEVPVGPQLIVKAQDKINAGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PDGF R beta Antibody (OTI1E8) [Janelia Fluor 646]
NBP2-73304JF646 0.1 mL

Mouse Monoclonal PDGF R beta Antibody (OTI1E8) [Janelia Fluor 646]

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 10G8 (OR10G8)
orb2906592-01 20 µg

Recombinant Human Olfactory receptor 10G8 (OR10G8)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 10G8 (OR10G8)
orb2906592-02 100 µg

Recombinant Human Olfactory receptor 10G8 (OR10G8)

Sign In for Pricing
View Details
1- (3- (Trifluoromethyl) phenyl) propan-2-ol
PC1006109-01 100 mg

1- (3- (Trifluoromethyl) phenyl) propan-2-ol

Sign In for Pricing
View Details
1- (3- (Trifluoromethyl) phenyl) propan-2-ol
PC1006109-02 250 mg

1- (3- (Trifluoromethyl) phenyl) propan-2-ol

Sign In for Pricing
View Details
1- (3- (Trifluoromethyl) phenyl) propan-2-ol
PC1006109-03 1 g

1- (3- (Trifluoromethyl) phenyl) propan-2-ol

Sign In for Pricing
View Details