Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A8G3H6

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGVYFTNYSEEKENIIIVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTSGTID SIDIIEDGSYKVNIENDNGEITTEEVPVGPQLIVKAQDKINAGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGM1 antibody
MBS200405-01 0.05 mL

PGM1 antibody

Sign In for Pricing
View Details
PGM1 antibody
MBS200405-02 0.1 mL

PGM1 antibody

Sign In for Pricing
View Details
PGM1 antibody
MBS200405-03 5x 0.05 mL

PGM1 antibody

Sign In for Pricing
View Details
PGM1 antibody
MBS200405-04 5x 0.1 mL

PGM1 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TDRD3 Antibody [Allophycocyanin]
NBP1-46821APC 0.1 mL

Rabbit Polyclonal TDRD3 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
HELT, ID (HELT, Hairy and enhancer of split-related protein HELT, HES/HEY-like transcription factor) (Azide free) (HRP)
MBS6306069-01 0.2 mL

HELT, ID (HELT, Hairy and enhancer of split-related protein HELT, HES/HEY-like transcription factor) (Azide free) (HRP)

Sign In for Pricing
View Details