Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthroderma gypseum Probable endonuclease LCL3 (LCL3)

This Recombinant Arthroderma gypseum Probable endonuclease LCL3 (LCL3) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Probable endonuclease LCL3, EC= 3.1.-.-

UniProt

E4V094

Expression Region

1-283

Origin

Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) (Microsporum gypseum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWLFWASDNDKDGCKCNSKSSSSSDEKPTAPLKSNKDWNSLSNAINWSHYAEPSNLIPT VLLTSGILFAFRIHRRYLRRIPEATNISPSYLRQRSILGKVTSVGDGDNFRIYHTPGGML AGWGWLRKVPTSKKELKNNTIHIRIAGVDAPELAHFGRPSQPFGEEAHKWLINRLTGRRI RAYVYRPDQYSRIVATVYAYRFLFFPQDIGLQMLREGLATVYEAKSGAEFGGPEQEKKYR DAEALAKKKGKGLWKTKGSNDWESPRDFKSRMNAIDQGKDSST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL
BNC880676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-100 1x 100 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), CF647 conjugate, 0.1mg/mL
BNC471830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details