Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q31C73

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGVYFTNYSEEKDNIIIVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTSGTIN SIDTIEDGSYKVNIENENGEITTEAVPVGPQLIVKAQDKINAGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 Antibody
KC-11011-01 50 μL

CD9 Antibody

Sign In for Pricing
View Details
CD9 Antibody
KC-11011-02 100 µL

CD9 Antibody

Sign In for Pricing
View Details
CD9 Antibody
KC-11011-03 1 mL

CD9 Antibody

Sign In for Pricing
View Details
CD7 (T-Cell Leukemia Marker) (CD7/3737), CF568 conjugate, 0.1mg/mL
BNC682056-500 1x 500 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rxfp1 Mouse Gene Knockout Kit (CRISPR)
KN515221 1 Kit

Rxfp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AGRP (NM_001138) Human Over-expression Lysate
LY420100 100 µg

AGRP (NM_001138) Human Over-expression Lysate

Sign In for Pricing
View Details