Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q31C73

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGVYFTNYSEEKDNIIIVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTSGTIN SIDTIEDGSYKVNIENENGEITTEAVPVGPQLIVKAQDKINAGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (TP53/1799R), CF740 conjugate, 0.1mg/mL
BNC741799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF405S conjugate, 0.1mg/mL
BNC041448-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SEMA4A (NM_022367) Human Over-expression Lysate
LY402923 100 µg

SEMA4A (NM_022367) Human Over-expression Lysate

Sign In for Pricing
View Details
MFluor™ Violet 550 SE
1153-AAT 1 mg

MFluor™ Violet 550 SE

Sign In for Pricing
View Details
Human KRCC1 activation kit by CRISPRa
GA109734 1 Kit

Human KRCC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse C4 (Complement Component 4) ELISA Kit
E-EL-M3020-01 24 Tests

Mouse C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details