Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 39-321.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q46GW2

Expression Region

39-321

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQKFENPREATGKIVCANCHVASMPTRAEVPQAVAADSVFKTVVEIPYKKDLQEI GADGSKVPLQVGAVVMLPDGFKLAPQERWTDEIKEETQGVYFTQYSEEQENIILVGPLPG DQNREIVFPVLSPDPRKDSNYNFGKYSIHVGGNRGRGQVYPTGEKSNNNLFTATNSGTIT SIETNEDGSQIINLNNEEGESFTENLPAGTSLLIKEGDTIEKGAKLTEDPNVGGFGQLDK EIVLQSKARVIGMIIFFIGVGLSQIMLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA62 (SNW1) (NM_012245) Human Over-expression Lysate
LC402178 20 µg

NCOA62 (SNW1) (NM_012245) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIB2 Polyclonal Antibody
E-AB-17148-01 20 µL

TRIB2 Polyclonal Antibody

Sign In for Pricing
View Details
TRIB2 Polyclonal Antibody
E-AB-17148-02 60 µL

TRIB2 Polyclonal Antibody

Sign In for Pricing
View Details
TRIB2 Polyclonal Antibody
E-AB-17148-03 120 µL

TRIB2 Polyclonal Antibody

Sign In for Pricing
View Details
TRIB2 Polyclonal Antibody
E-AB-17148-04 200 µL

TRIB2 Polyclonal Antibody

Sign In for Pricing
View Details
STAT2 Rabbit Polyclonal Antibody
TA392619 100 µL

STAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details