Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 39-321.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q46GW2

Expression Region

39-321

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQKFENPREATGKIVCANCHVASMPTRAEVPQAVAADSVFKTVVEIPYKKDLQEI GADGSKVPLQVGAVVMLPDGFKLAPQERWTDEIKEETQGVYFTQYSEEQENIILVGPLPG DQNREIVFPVLSPDPRKDSNYNFGKYSIHVGGNRGRGQVYPTGEKSNNNLFTATNSGTIT SIETNEDGSQIINLNNEEGESFTENLPAGTSLLIKEGDTIEKGAKLTEDPNVGGFGQLDK EIVLQSKARVIGMIIFFIGVGLSQIMLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS622097 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
1200002N14Rik (BC021433) Mouse Tagged ORF Clone
MG200764 10 µg

1200002N14Rik (BC021433) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), Biotin conjugate, 0.1mg/mL
BNCB2419-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MGluR6 Antibody
8C0210-AAT 50 µg

MGluR6 Antibody

Sign In for Pricing
View Details
SGT1 (ECD) (NM_001135752) Human Over-expression Lysate
LY427697 100 µg

SGT1 (ECD) (NM_001135752) Human Over-expression Lysate

Sign In for Pricing
View Details
IRF8 Recombinant Rabbit monoclonal Antibody
HA723174 100 µL

IRF8 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details