Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L323 (MIMI_L323)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L323 (MIMI_L323) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Uncharacterized protein L323

UniProt

Q5UQR8

Expression Region

1-283

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGASASTNEQIIENRILNEAYNSCPSVGTANVTTLSGIKFEAPANCNPPSAFVIGQTATV DSNCLLTSLQKGAASAASKLSSQSKAGLGISVSTNISEVENSIANITNNTCAGLATNNVV DITDTVIKACQFRVVQNASSKVSCQINNTQNLISKIAADATSQAKGGSLFGDLFGGGLGG IIAAIIIIVIIAVIIGAVVYFIKQSSKNKGAEKIIENPETAALLVGGFKSFIGGASDFVD GLKKTNMYKFIVLLIMVLIIVILLKTLDIPNPINHPNDSNRIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inosine 5’ Triphosphate Trisodium Salt
TRC-I665000-1G 1 g

Inosine 5’ Triphosphate Trisodium Salt

Sign In for Pricing
View Details
MLH1 (MutL Homolog 1) (MLH1/1324), CF568 conjugate, 0.1mg/mL
BNC681324-500 1x 500 µL

MLH1 (MutL Homolog 1) (MLH1/1324), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TM2D2 Human qPCR Primer Pair (NM_078473)
HP225838 200 Reactions

TM2D2 Human qPCR Primer Pair (NM_078473)

Sign In for Pricing
View Details
Human TBC1D2 activation kit by CRISPRa
GA110734 1 Kit

Human TBC1D2 activation kit by CRISPRa

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF568 conjugate, 0.1mg/mL
BNC681791-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1791), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR560056 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details