Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L323 (MIMI_L323)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L323 (MIMI_L323) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Uncharacterized protein L323

UniProt

Q5UQR8

Expression Region

1-283

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGASASTNEQIIENRILNEAYNSCPSVGTANVTTLSGIKFEAPANCNPPSAFVIGQTATV DSNCLLTSLQKGAASAASKLSSQSKAGLGISVSTNISEVENSIANITNNTCAGLATNNVV DITDTVIKACQFRVVQNASSKVSCQINNTQNLISKIAADATSQAKGGSLFGDLFGGGLGG IIAAIIIIVIIAVIIGAVVYFIKQSSKNKGAEKIIENPETAALLVGGFKSFIGGASDFVD GLKKTNMYKFIVLLIMVLIIVILLKTLDIPNPINHPNDSNRIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isopropyl 4-Hydroxy-3,5-diisopropylbenzoate
TRC-I822250-250MG 250 mg

Isopropyl 4-Hydroxy-3,5-diisopropylbenzoate

Sign In for Pricing
View Details
DNL1 Antibody
8C13044-AAT 50 µg

DNL1 Antibody

Sign In for Pricing
View Details
Human ENO3 activation kit by CRISPRa
GA101408 1 Kit

Human ENO3 activation kit by CRISPRa

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF640R conjugate, 0.1mg/mL
BNC401950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lin28 Recombinant Rabbit Monoclonal Antibody [JA10-63]
ET1704-26 100 µL

Lin28 Recombinant Rabbit Monoclonal Antibody [JA10-63]

Sign In for Pricing
View Details
CUEDC2 (C-term) Rabbit Polyclonal Antibody
AP17264PU-N 400 µL

CUEDC2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details