Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 28-310.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q7VDC1

Expression Region

28-310

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYENPREATGKLVCANCHLAKMTTQVEVPQSVGADSVFKAAVKIPYKPGTEEI GADGSKVPLQVGAVVMLPDGFKLAPQDRWTEDIKEETKGVYFTQYSEEKDNIILVGPLPG DQNKEIVFPILSPDPAKDKNIHFGKYSINVGGNRGRGQVYPTGEKSNNSIFTSTAAGLIS TIEPNKDGGTNITIQTESGEAIIEEIPVGPSLVVKEGQTIDIGIPLTSDPNVGGFGQLDT EIVLQSPARVIGLIAFFAGVALTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Neurotrophin-3 (NTF3)
orb1095991-01 20 µg

Recombinant Human Neurotrophin-3 (NTF3)

Sign In for Pricing
View Details
Recombinant Human Neurotrophin-3 (NTF3)
orb1095991-02 100 µg

Recombinant Human Neurotrophin-3 (NTF3)

Sign In for Pricing
View Details
Recombinant Human Neurotrophin-3 (NTF3)
orb1095991-03 1 mg

Recombinant Human Neurotrophin-3 (NTF3)

Sign In for Pricing
View Details
Mouse Actin filament associated protein 1 like 1 (AFAP1L1) ELISA kit
GTR10427493 96 Well

Mouse Actin filament associated protein 1 like 1 (AFAP1L1) ELISA kit

Sign In for Pricing
View Details
Rabbit anti-rat Caprin-1 polyclonal Antibody(Caprin1), HRP conjugated
MBS1495304-01 0.05 mg

Rabbit anti-rat Caprin-1 polyclonal Antibody(Caprin1), HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-rat Caprin-1 polyclonal Antibody(Caprin1), HRP conjugated
MBS1495304-02 0.1 mg

Rabbit anti-rat Caprin-1 polyclonal Antibody(Caprin1), HRP conjugated

Sign In for Pricing
View Details