Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 28-310.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q7VDC1

Expression Region

28-310

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYENPREATGKLVCANCHLAKMTTQVEVPQSVGADSVFKAAVKIPYKPGTEEI GADGSKVPLQVGAVVMLPDGFKLAPQDRWTEDIKEETKGVYFTQYSEEKDNIILVGPLPG DQNKEIVFPILSPDPAKDKNIHFGKYSINVGGNRGRGQVYPTGEKSNNSIFTSTAAGLIS TIEPNKDGGTNITIQTESGEAIIEEIPVGPSLVVKEGQTIDIGIPLTSDPNVGGFGQLDT EIVLQSPARVIGLIAFFAGVALTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Bcl-2 Antibody (bcl-2/124) [DyLight 350]
NBP2-50116UV 0.1 mL

Mouse Monoclonal Bcl-2 Antibody (bcl-2/124) [DyLight 350]

Sign In for Pricing
View Details
Baricitinib Nitroso Impurity 146
RM-B180446-01 10 mg

Baricitinib Nitroso Impurity 146

Sign In for Pricing
View Details
Baricitinib Nitroso Impurity 146
RM-B180446-02 25 mg

Baricitinib Nitroso Impurity 146

Sign In for Pricing
View Details
Baricitinib Nitroso Impurity 146
RM-B180446-03 50 mg

Baricitinib Nitroso Impurity 146

Sign In for Pricing
View Details
Baricitinib Nitroso Impurity 146
RM-B180446-04 100 mg

Baricitinib Nitroso Impurity 146

Sign In for Pricing
View Details
OBFC2A sgRNA CRISPR Lentivector set (Human)
K1474001 3x 1.0 µg

OBFC2A sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details