Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q7V2L5

Expression Region

35-317

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKDDIKEI GADGSAVPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGVYFTNYSEEKDNIILVGPLPG DTNKEIVFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGEKSNNVIFTSSSAGTIN SIETIEDGSYQINIENENGDIVTEAVPVGPKLIVKEQDQISAGDPLTNDPNVGGFGQLDA EVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF18B Human shRNA Plasmid Kit (Locus ID 146909)
TR320883 1 Kit

KIF18B Human shRNA Plasmid Kit (Locus ID 146909)

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)
MBS1394249-01 0.02 mg (E-Coli)

Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)
MBS1394249-02 0.02 mg (Yeast)

Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)
MBS1394249-03 0.1 mg (E-Coli)

Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)
MBS1394249-04 0.1 mg (Yeast)

Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)

Sign In for Pricing
View Details
Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)
MBS1394249-05 0.02 mg (Baculovirus)

Recombinant Psychrobacter cryohalolentis Putative phosphotransferase Pcryo_1035 (Pcryo_1035)

Sign In for Pricing
View Details