Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q7V2L5

Expression Region

35-317

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKDDIKEI GADGSAVPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGVYFTNYSEEKDNIILVGPLPG DTNKEIVFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGEKSNNVIFTSSSAGTIN SIETIEDGSYQINIENENGDIVTEAVPVGPKLIVKEQDQISAGDPLTNDPNVGGFGQLDA EVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human F5 shRNA (UAS) - Lentiviral human F5 shRNA (UAS, iRFP) (25)
GTR15111890 1 Vial

Lentiviral human F5 shRNA (UAS) - Lentiviral human F5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Anti-Parathyroid Hormone Receptor 1/PTH1R Antibody Picoband®, Cy3 Conjugate
PA2132-Cy3 100 µg/Vial

Anti-Parathyroid Hormone Receptor 1/PTH1R Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
PAG1 Recombinant Protein
OPCD05958-200UG 200 µg

PAG1 Recombinant Protein

Sign In for Pricing
View Details
Adenine Hemisulfate Dihydrate
sc-291835B 50 g

Adenine Hemisulfate Dihydrate

Sign In for Pricing
View Details
Rabbit Polyclonal Stanniocalcin 1/STC-1 Antibody [CoraFluor 1]
NBP2-97046CL1 0.1 mL

Rabbit Polyclonal Stanniocalcin 1/STC-1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
SBP-2 (C-10) Alexa Fluor® 488
sc-393651 AF488 200 µg/mL

SBP-2 (C-10) Alexa Fluor® 488

Sign In for Pricing
View Details