Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q7V2L5

Expression Region

35-317

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKDDIKEI GADGSAVPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGVYFTNYSEEKDNIILVGPLPG DTNKEIVFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGEKSNNVIFTSSSAGTIN SIETIEDGSYQINIENENGDIVTEAVPVGPKLIVKEQDQISAGDPLTNDPNVGGFGQLDA EVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lymph OptiTDS™1: Tissue Dissociation System
4-28185 1 Kit

Mouse Lymph OptiTDS™1: Tissue Dissociation System

Sign In for Pricing
View Details
Cyanamide discontinued
267357-01 25 g

Cyanamide discontinued

Sign In for Pricing
View Details
Cyanamide discontinued
267357-02 50 g

Cyanamide discontinued

Sign In for Pricing
View Details
Cyanamide discontinued
267357-03 100 g

Cyanamide discontinued

Sign In for Pricing
View Details
Cyanamide discontinued
267357-04 250 g

Cyanamide discontinued

Sign In for Pricing
View Details
Cyanamide discontinued
267357-05 500 g

Cyanamide discontinued

Sign In for Pricing
View Details